PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10041001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family MYB
Protein Properties Length: 301aa    MW: 31448.8 Da    PI: 6.6059
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10041001genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding29.41.8e-091154344
                     SS-HHHHHHHHHHHHHTTTT...-HHHHHHHHTTTS-HHHHHHHH CS
  Myb_DNA-binding  3 rWTteEdellvdavkqlGgg...tWktIartmgkgRtlkqcksrw 44
                     +WT e d  + +a + ++ +   +W++Ia+ +  g+tl+++k+++
      Lus10041001 11 SWTREQDSAFENALATYPEDdsdRWEKIAAGVE-GKTLEEVKDHF 54
                     7********************************.**********8 PP

2Myb_DNA-binding43.86e-14122166347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +WT++E+ l++ + +++G+g+W++I+r +  +Rt+ q+ s+ qky
      Lus10041001 122 AWTEDEHRLFLLGLEKYGKGDWRSISRNFVVTRTPTQVASHAQKY 166
                      6*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512938.719762IPR017884SANT domain
SMARTSM007179.3E-9860IPR001005SANT/Myb domain
PfamPF002497.6E-71154IPR001005SANT/Myb domain
CDDcd001673.14E-81158No hitNo description
SuperFamilySSF466892.44E-101165IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.609.2E-41154IPR009057Homeodomain-like
PROSITE profilePS5129417.61114171IPR017930Myb domain
SuperFamilySSF466898.97E-17117172IPR009057Homeodomain-like
SMARTSM007174.5E-11119169IPR001005SANT/Myb domain
TIGRFAMsTIGR015571.5E-17119169IPR006447Myb domain, plants
Gene3DG3DSA:1.10.10.605.3E-11122165IPR009057Homeodomain-like
PfamPF002497.5E-12122166IPR001005SANT/Myb domain
CDDcd001671.35E-10122167No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 301 aa     Download sequence    Send to blast
MAVDEVGSSC SWTREQDSAF ENALATYPED DSDRWEKIAA GVEGKTLEEV KDHFDLLLED  60
IGLIESGCVP LPSYNSSSES STSHGGDEGT GKKGGHGGNN NSESNQGNKG SRADQERRKG  120
IAWTEDEHRL FLLGLEKYGK GDWRSISRNF VVTRTPTQVA SHAQKYFIRL NSMNKDRRRS  180
SIHDITSLNN GEIAAAQGPI TGQTNGASAG VGGSGKSGKQ PSQHPGGPPG VVGIYGAPTI  240
GQPIGGPLVS AVGTPVNLAS PAHMAYGVRA PVPGAMVPGA PMTMGGPMAY PMPPTTSAHR  300
*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2cjj_A1e-17777676RADIALIS
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008360003.11e-171PREDICTED: transcription factor DIVARICATA-like
RefseqXP_008360004.11e-171PREDICTED: transcription factor DIVARICATA-like
RefseqXP_008360005.11e-171PREDICTED: transcription factor DIVARICATA-like
RefseqXP_008360006.11e-171PREDICTED: transcription factor DIVARICATA-like
SwissprotQ8S9H73e-61DIV_ANTMA; Transcription factor DIVARICATA
TrEMBLD9ZJ781e-170D9ZJ78_MALDO; MYBR domain class transcription factor
STRINGGLYMA07G28310.11e-161(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF46943358
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G08520.15e-94MYB family protein